Web Analysis for Superaffiliatesmarketingsystem - superaffiliatesmarketingsystem.com
Super Affiliate System's training course has created FIVE 7-FIGURE marketers...affiliate marketing, just plain works.
superaffiliatesmarketingsystem.com is 4 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, superaffiliatesmarketingsystem.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | 6 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.168.131.241)
ImageShack - Best place for all of your image hosting and image sharin
Unlimited space to host images, easy to use image uploader, albums, photo hosting, sharing, dynamic image resizing on web and mobile.
مجلة سيدتي | الصفحة الرئيسية
سيدتي نت موقع لمجلة المرأة العربية يطرح قضايا ونصائح خاصة بالمرأة والمجتمع في مختلف المجالات. سواء في الصحة، التغذية، الجمال، الأزياء، الرشاقة، المطبخ والأطفال.
The Best YouTube to MP3 Converter - IXConverter.com
Download and Convert your favorite online videos and audio to MP3, MP4, WEBM, F4V, and 3GP formats for free!
Haber365 | Haber, Haberler, Son Dakika Haberleri
Haber365, güncel haberler, haber, en son haber, son dakika haberler ve 365 gün tüm kategorilerde güncel gelişmeler haber sitesi Haber365.com.tr'de.
HTTP Header Analysis
Server: nginx/1.12.2
Date: Thu, 26 Mar 2020 17:01:00 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: close
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns35.domaincontrol.com | 97.74.107.18 | United States of America | |
ns36.domaincontrol.com | 173.201.75.18 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
superaffiliatesmarketingsystem.com | A | 600 |
IP: 184.168.131.241 |
superaffiliatesmarketingsystem.com | NS | 3600 |
Target: ns35.domaincontrol.com |
superaffiliatesmarketingsystem.com | NS | 3600 |
Target: ns36.domaincontrol.com |
superaffiliatesmarketingsystem.com | SOA | 600 |
MNAME: ns35.domaincontrol.com RNAME: dns.jomax.net Serial: 2020032201 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
Full WHOIS Lookup
Registry Domain ID: 2504234376_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-03-17T07:42:35Z
Creation Date: 2020-03-17T07:42:34Z
Registrar Registration Expiration Date: 2021-03-17T07:42:34Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: 1976
Registrant State/Province: New Jersey
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=superaffiliatesmarketingsystem.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=superaffiliatesmarketingsystem.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=superaffiliatesmarketingsystem.com
Name Server: NS35.DOMAINCONTROL.COM
Name Server: NS36.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-03-26T17:00:00Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
Notes:
IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.